Recombinant Human CLECL1 Protein, N-His tagged

• Cat.No.: CLECL1-02H
• Product Overview: Recombinant Human CLECL1 Protein with N-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: The protein has a calculated MW of 11 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/mL by BCA
• Storage Buffer: Sterile 20 mM Tris, 150 mM NaCl, 0.5M Argine, 10% Glycerol, pH8.5

Gene Information

• Gene Name: CLECL1 C-type lectin-like 1 [ Homo sapiens ]
• Official Symbol: CLECL1
• Synonyms: CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1
• Gene ID: 160365
• mRNA Refseq: NM_001253748
• Protein Refseq: NP_001240677
• MIM: 607467
• UniProt ID: Q8IZS7