Recombinant Human CLECL1 protein, His & Myc-tagged

• Cat.No.: CLECL1-2383H
• Product Overview: Recombinant Human CLECL1 protein(Q8IZS7)(89-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 89-167aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13 kDa
• AA Sequence: KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CLECL1 C-type lectin-like 1 [ Homo sapiens ]
• Official Symbol: CLECL1
• Synonyms: CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1
• Gene ID: 160365
• mRNA Refseq: NM_001253748
• Protein Refseq: NP_001240677
• MIM: 607467
• UniProt ID: Q8IZS7