Recombinant Human CLECL1 Protein, GST-tagged

• Cat.No.: CLECL1-2382H
• Product Overview: Human DCAL1 partial ORF ( NP_742001.1, 82 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
• Molecular Mass: 35.2 kDa
• AA Sequence: DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLECL1 C-type lectin-like 1 [ Homo sapiens ]
• Official Symbol: CLECL1
• Synonyms: CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1
• Gene ID: 160365
• mRNA Refseq: NM_001253748
• Protein Refseq: NP_001240677
• MIM: 607467
• UniProt ID: Q8IZS7