Recombinant Human CLEC6A protein, His-tagged

• Cat.No.: CLEC6A-8529H
• Product Overview: Recombinant Human CLEC6A protein(Thr42-Leu209), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: C-His
• Protein length: Thr42-Leu209
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
• Molecular Mass: The protein has a calculated MW of 21 kDa.
• AASequence: TYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYLAHHHHHHHHHH
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CLEC6A C-type lectin domain family 6, member A [ Homo sapiens ]
• Official Symbol: CLEC6A
• Synonyms: CLEC6A; C-type lectin domain family 6, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 10 , CLECSF10; C-type lectin domain family 6 member A; dectin 2; dectin-2; DC-associated C-type lectin 2; C-type lectin superfamily member 10; dendritic cell-associated C-type lectin 2; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10; CLEC4N; CLECSF10
• Gene ID: 93978
• mRNA Refseq: NM_001007033
• Protein Refseq: NP_001007034
• MIM: 613579
• UniProt ID: Q6EIG7