Recombinant Human CLEC6A protein, His-tagged

Cat.No. : CLEC6A-8529H
Product Overview : Recombinant Human CLEC6A protein(Thr42-Leu209), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Thr42-Leu209
Tag : C-His
Form : Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
Molecular Mass : The protein has a calculated MW of 21 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYLAHHHHHHHHHH
Gene Name CLEC6A C-type lectin domain family 6, member A [ Homo sapiens ]
Official Symbol CLEC6A
Synonyms CLEC6A; C-type lectin domain family 6, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 10 , CLECSF10; C-type lectin domain family 6 member A; dectin 2; dectin-2; DC-associated C-type lectin 2; C-type lectin superfamily member 10; dendritic cell-associated C-type lectin 2; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10; CLEC4N; CLECSF10;
Gene ID 93978
mRNA Refseq NM_001007033
Protein Refseq NP_001007034
MIM 613579
UniProt ID Q6EIG7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC6A Products

Required fields are marked with *

My Review for All CLEC6A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon