Recombinant Human CLEC5C Protein, His-SUMO-tagged
| Cat.No. : | CLEC4C-1168H |
| Product Overview : | Recombinant Human CLEC4C Protein (45-213aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 36 kDa |
| AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN FRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 45-213 a.a. |
| Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] |
| Official Symbol | CLEC4C |
| Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 |
| Gene ID | 170482 |
| mRNA Refseq | NM_203503.1 |
| Protein Refseq | NP_987099.1 |
| MIM | 606677 |
| UniProt ID | Q8WTT0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *
0
Inquiry Basket
