Recombinant Human CLEC5C Protein, His-SUMO-tagged

Cat.No. : CLEC4C-1168H
Product Overview : Recombinant Human CLEC4C Protein (45-213aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 45-213 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 36 kDa
AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM
GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN
FRSSEEWGWNDIHCHVPQKSICKMKKIYI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
Official Symbol CLEC4C
Synonyms DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Gene ID 170482
mRNA Refseq NM_203503.1
Protein Refseq NP_987099.1
MIM 606677
UniProt ID Q8WTT0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC4C Products

Required fields are marked with *

My Review for All CLEC4C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon