Recombinant Human CLEC4C protein, His-Myc-tagged
Cat.No. : | CLEC4C-6744H |
Product Overview : | Recombinant Human CLEC4C protein(Q8WTT0)(45-213aa), fused with N-terminal His and Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&Myc |
Protein Length : | 45-213aa |
Tag : | N-His-Myc |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody,the EC50 is 7.658-12.99 ng/mL. |
Molecular Mass : | 24.1 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] |
Official Symbol | CLEC4C |
Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 |
Gene ID | 170482 |
mRNA Refseq | NM_203503.1 |
Protein Refseq | NP_987099.1 |
MIM | 606677 |
UniProt ID | Q8WTT0 |
◆ Recombinant Proteins | ||
CLEC4C-1167H | Recombinant Human CLEC4C protein, His-tagged | +Inquiry |
CLEC4C-3045C | Recombinant Cynomolgus CLEC4C protein, hFc-tagged | +Inquiry |
CLEC4C-026H | Recombinant Human CLEC4C Protein, His-tagged | +Inquiry |
CLEC4C-269H | Active Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
CLEC4C-45H | Recombinant Human CLEC4C Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *
0
Inquiry Basket