Recombinant Human CLEC4C Protein (45-213 aa), His-tagged

Cat.No. : CLEC4C-2074H
Product Overview : Recombinant Human CLEC4C Protein (45-213 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 45-213 aa
Description : Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.0 kDa
AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
Official Symbol CLEC4C
Synonyms DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150;
Gene ID 170482
mRNA Refseq NM_203503.1
Protein Refseq NP_987099.1
MIM 606677
UniProt ID Q8WTT0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC4C Products

Required fields are marked with *

My Review for All CLEC4C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon