Recombinant Human CLEC4C Protein (45-213 aa), His-tagged
Cat.No. : | CLEC4C-2074H |
Product Overview : | Recombinant Human CLEC4C Protein (45-213 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 45-213 aa |
Description : | Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.0 kDa |
AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] |
Official Symbol | CLEC4C |
Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150; |
Gene ID | 170482 |
mRNA Refseq | NM_203503.1 |
Protein Refseq | NP_987099.1 |
MIM | 606677 |
UniProt ID | Q8WTT0 |
◆ Recombinant Proteins | ||
CLEC4C-1167H | Recombinant Human CLEC4C protein, His-tagged | +Inquiry |
CLEC4C-2214H | Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
CLEC4C-1734H | Recombinant Human CLEC4C protein, His-tagged | +Inquiry |
CLEC4C-3045C | Recombinant Cynomolgus CLEC4C protein, hFc-tagged | +Inquiry |
CLEC4C-4061H | Recombinant Human CLEC4C Protein (Asn45-IIe213), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *
0
Inquiry Basket