Recombinant Human CLEC4M Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLEC4M-6556H |
Product Overview : | CLEC4M MS Standard C13 and N15-labeled recombinant protein (NP_999840) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209, also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLEC4M C-type lectin domain family 4 member M [ Homo sapiens (human) ] |
Official Symbol | CLEC4M |
Synonyms | CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN; CD299 antigen; DC-SIGN-related protein; CD209 antigen-like protein 1; mannose binding C-type lectin DC-SIGNR; dendritic cell-specific ICAM-3-grabbing non-integrin 2; liver/lymph node-specific ICAM-3 grabbing non-integrin; liver/lymph node-specific ICAM-3-grabbing non-integrin; CD299; CD209L; L-SIGN; DC-SIGN2; DC-SIGNR; MGC47866; MGC129964; |
Gene ID | 10332 |
mRNA Refseq | NM_214675 |
Protein Refseq | NP_999840 |
MIM | 605872 |
UniProt ID | Q9H2X3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CLEC4M Products
Required fields are marked with *
My Review for All CLEC4M Products
Required fields are marked with *
0
Inquiry Basket