Recombinant Human CLEC4M Protein, His-tagged

• Cat.No.: CLEC4M-007H
• Product Overview: Recombinant Human CLEC4M Protein with His tag was expressed in E. coli.

Specification

• Description: Dendritic cells (DC) are antigen-presenting immune system cells that are present on peripheral mucosal tissues and migrate to lymphoid tissues. DC-SIGN (DC-specific ICAM-3 grabbing nonintegrin) is a type II membrane protein that is exclusively expressed by DC. DC-SIGN, also designated CD209, binds to ICAM-3 to mediate the initial interaction between DC and resting T cells through the immunological synapse. The DC that are present in the initial sites of HIV-1 infection capture HIV-1 through DC-SIGN, which then facilitates the migration of DC to areas of T cell-rich secondary lymphoid organs, where it promotes efficient trans HIV-1 infection of these T cells. DC-SIGNR (DC-SIGNrelated molecule), also designated CD209L and L-SIGN (liver/lymph nodespecific ICAM-3 grabbing nonintegrin), is a type II integral membrane protein that is 77% identical to DC-SIGN. It is expressed on sinusoidal endothelial cells and binds the E2 glycoproteins of the hepatitis C virus.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~38 kDa
• AA Sequence: MQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CLEC4M C-type lectin domain family 4, member M [ Homo sapiens (human) ]
• Official Symbol: CLEC4M
• Synonyms: CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN; CD299 antigen; DC-SIGN-related protein; CD209 antigen-like protein 1; mannose binding C-type lectin DC-SIGNR; dendritic cell-specific ICAM-3-grabbing non-integrin 2; liver/lymph node-specific ICAM-3 grabbing non-integrin; liver/lymph node-specific ICAM-3-grabbing non-integrin; CD299; CD209L; L-SIGN; DC-SIGN2; DC-SIGNR; MGC47866; MGC129964
• Gene ID: 10332
• mRNA Refseq: NM_001144904
• Protein Refseq: NP_001138376
• MIM: 605872
• UniProt ID: Q9H2X3