Recombinant Human CLEC4M, FC-tagged

• Cat.No.: CLEC4M-26929TH
• Product Overview: Recombinant fragment corresponding to extracellular domain amino acids 71-398 of Human CD299, fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified Human 293 cells using a DNA sequence encoding the signal peptide

Specification

• Species: Human
• Tag: Fc
• Protein Length: 71-398 a.a.
• Description: This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
• Conjugation: Fc
• Tissue specificity: Predominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical sequence:HGTELPSPPSKLQVSKVPSSLSQEQSEQD AIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGE LPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELT RLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGEL PDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNC YFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQL QTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYW NSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
• Sequence Similarities: Contains 1 C-type lectin domain.

Gene Information

• Gene ID: CLEC4M C-type lectin domain family 4, member M [ Homo sapiens ]
• Official Symbol: CLEC4M
• Synonyms: CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN