Recombinant Human CLCF1, His-tagged

• Cat.No.: CLCF1-29299TH
• Product Overview: Recombinant full length Human NNT1 with an N terminal His tag; 219aa, 24.6kDa inclusive of tag.

Specification

• Description: This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Protein length: 198 amino acids
• Conjugation: HIS
• Molecular Weight: 24.600kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 3.50Constituents:10% Glycerol, 2.4% Urea, 0.59% Sodium citrate
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
• Sequence Similarities: Belongs to the IL-6 superfamily.

Gene Information

• Gene Name: CLCF1 cardiotrophin-like cytokine factor 1 [ Homo sapiens ]
• Official Symbol: CLCF1
• Synonyms: CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6
• Gene ID: 23529
• mRNA Refseq: NM_001166212
• Protein Refseq: NP_001159684
• MIM: 607672
• Uniprot ID: Q9UBD9
• Chromosome Location: 11q13.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: ciliary neurotrophic factor receptor binding; contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine activity; growth factor activity