Recombinant Human CKM Protein, His-tagged

• Cat.No.: CKM-317H
• Product Overview: Recombinant Human CKM fused with His tag at C-terminal was expressed in HEK293.

Specification

• Description: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, 10%Glycerol, pH7.5
• Molecular Mass: 44.1kD
• Identity: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• AA Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH*
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: CKM creatine kinase, muscle [ Homo sapiens ]
• Official Symbol: CKM
• Synonyms: CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK
• Gene ID: 1158
• mRNA Refseq: NM_001824
• Protein Refseq: NP_001815
• MIM: 123310
• UniProt ID: P06732