Recombinant Human CIAO1 protein, His-SUMO-tagged

• Cat.No.: CIAO1-2698H
• Product Overview: Recombinant Human CIAO1 protein(O76071)(1-339aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-339aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.8 kDa
• AA Sequence: MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CIAO1 cytosolic iron-sulfur protein assembly 1 [ Homo sapiens ]
• Official Symbol: CIAO1
• Synonyms: CIAO1; cytosolic iron-sulfur protein assembly 1; cytosolic iron sulfur protein assembly 1 homolog (S. cerevisiae) , WD repeat domain 39 , WDR39; probable cytosolic iron-sulfur protein assembly protein CIAO1; CIA1; WD40 protein Ciao1; WD repeat domain 39; WD repeat-containing protein 39; cytosolic iron-sulfur protein assembly 1 homolog; WDR39
• Gene ID: 9391
• mRNA Refseq: NM_004804
• Protein Refseq: NP_004795
• MIM: 604333
• UniProt ID: O76071