Recombinant Human CIAO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CIAO1-5681H
• Product Overview: CIAO1 MS Standard C13 and N15-labeled recombinant protein (NP_004795) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CIAO1 (Cytosolic Iron-Sulfur Assembly Component 1) is a Protein Coding gene. Diseases associated with CIAO1 include Progressive External Ophthalmoplegia With Mitochondrial Dna Deletions, Autosomal Dominant 6 and Xeroderma Pigmentosum, Variant Type. Among its related pathways are Glucose / Energy Metabolism and Metabolism.
• Molecular Mass: 37.8 kDa
• AA Sequence: MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CIAO1 cytosolic iron-sulfur protein assembly 1 [ Homo sapiens (human) ]
• Official Symbol: CIAO1
• Synonyms: CIAO1; cytosolic iron-sulfur protein assembly 1; cytosolic iron sulfur protein assembly 1 homolog (S. cerevisiae), WD repeat domain 39, WDR39; probable cytosolic iron-sulfur protein assembly protein CIAO1; CIA1; WD40 protein Ciao1; WD repeat domain 39; WD repeat-containing protein 39; cytosolic iron-sulfur protein assembly 1 homolog; WDR39
• Gene ID: 9391
• mRNA Refseq: NM_004804
• Protein Refseq: NP_004795
• MIM: 604333
• UniProt ID: O76071