Recombinant Human CHRNA3 Protein (32-240 aa), His-tagged

• Cat.No.: CHRNA3-2691H
• Product Overview: Recombinant Human CHRNA3 Protein (32-240 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.0 kDa
• Protein length: 32-240 aa
• AA Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA3
• Synonyms: CHRNA3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); LNCR2; PAOD2; NACHRA3; MGC104879
• Gene ID: 1136
• mRNA Refseq: NM_000743
• Protein Refseq: NP_000734
• MIM: 118503
• UniProt ID: P32297