Recombinant Human CHRM5 Protein, GST-Tagged

Cat.No. : CHRM5-1276H
Product Overview : Human CHRM5 partial ORF (NP_036257, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ]
Official Symbol CHRM5
Synonyms CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838;
Gene ID 1133
mRNA Refseq NM_012125
Protein Refseq NP_036257
MIM 118496
UniProt ID P08912

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHRM5 Products

Required fields are marked with *

My Review for All CHRM5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon