Recombinant Human CHRM5 protein, His-tagged

• Cat.No.: CHRM5-4533H
• Product Overview: Recombinant Human CHRM5 protein(P08912)(215-443aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 215-443aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.5 kDa
• AASequence: RIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ]
• Official Symbol: CHRM5
• Synonyms: CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838
• Gene ID: 1133
• mRNA Refseq: NM_012125
• Protein Refseq: NP_036257
• MIM: 118496
• UniProt ID: P08912