Recombinant Human CHRM5 protein, His-tagged
Cat.No. : | CHRM5-4533H |
Product Overview : | Recombinant Human CHRM5 protein(P08912)(215-443aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 215-443aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQT |
Gene Name | CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ] |
Official Symbol | CHRM5 |
Synonyms | CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838; |
Gene ID | 1133 |
mRNA Refseq | NM_012125 |
Protein Refseq | NP_036257 |
MIM | 118496 |
UniProt ID | P08912 |
◆ Recombinant Proteins | ||
CHRM5-1388R | Recombinant Rat CHRM5 Protein | +Inquiry |
CHRM5-3428M | Recombinant Mouse CHRM5 Protein | +Inquiry |
CHRM5-1276H | Recombinant Human CHRM5 Protein, GST-Tagged | +Inquiry |
RFL9585HF | Recombinant Full Length Human Muscarinic Acetylcholine Receptor M5(Chrm5) Protein, His-Tagged | +Inquiry |
CHRM5-3194C | Recombinant Chicken CHRM5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM5-7518HCL | Recombinant Human CHRM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM5 Products
Required fields are marked with *
My Review for All CHRM5 Products
Required fields are marked with *
0
Inquiry Basket