Recombinant Human CH25H Protein, GST-Tagged

• Cat.No.: CH25H-1196H
• Product Overview: Human CH25H full-length ORF (NP_003947.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 58.1 kDa
• AA Sequence: MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CH25H cholesterol 25-hydroxylase [ Homo sapiens ]
• Official Symbol: CH25H
• Synonyms: CH25H; cholesterol 25-hydroxylase; h25OH; cholesterol 25-monooxygenase; C25H
• Gene ID: 9023
• mRNA Refseq: NM_003956
• Protein Refseq: NP_003947
• MIM: 604551
• UniProt ID: O95992