Recombinant Human CETN1

• Cat.No.: CETN1-27954TH
• Product Overview: Recombinant fragment of Human Centrin 1 with N terminal proprietary tag, 34.32kDa.

Specification

• Description: The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
• Protein length: 79 amino acids
• Molecular Weight: 34.320kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVM
• Sequence Similarities: Belongs to the centrin family.Contains 4 EF-hand domains.
• Tag: Non

Gene Information

• Gene Name: CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
• Official Symbol: CETN1
• Synonyms: CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1
• Gene ID: 1068
• mRNA Refseq: NM_004066
• Protein Refseq: NP_004057
• MIM: 603187
• Uniprot ID: Q12798
• Chromosome Location: 18p11.32
• Function: ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding