Recombinant Human CETN1 Protein, GST-Tagged

Cat.No. : CETN1-1153H
Product Overview : Human CETN1 full-length ORF (NP_004057.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015]
Molecular Mass : 46 kDa
AA Sequence : MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
Official Symbol CETN1
Synonyms CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1; caltractin; EF-hand protein; calcium binding protein;
Gene ID 1068
mRNA Refseq NM_004066
Protein Refseq NP_004057
MIM 603187
UniProt ID Q12798

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CETN1 Products

Required fields are marked with *

My Review for All CETN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon