Recombinant Human CETN1 Protein, GST-Tagged

• Cat.No.: CETN1-1153H
• Product Overview: Human CETN1 full-length ORF (NP_004057.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46 kDa
• AA Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
• Official Symbol: CETN1
• Synonyms: CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1; caltractin; EF-hand protein; calcium binding protein
• Gene ID: 1068
• mRNA Refseq: NM_004066
• Protein Refseq: NP_004057
• MIM: 603187
• UniProt ID: Q12798