Recombinant Human CERCAM Protein, GST-Tagged

Cat.No. : CERCAM-1146H
Product Overview : Human CEECAM1 full-length ORF (NP_057258.2, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CERCAM (Cerebral Endothelial Cell Adhesion Molecule) is a Protein Coding gene. An important paralog of this gene is COLGALT1.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 85.5 kDa
AA Sequence : MLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPRMQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFESNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CERCAM cerebral endothelial cell adhesion molecule [ Homo sapiens ]
Official Symbol CERCAM
Synonyms CERCAM; cerebral endothelial cell adhesion molecule; CEECAM1, cerebral cell adhesion molecule; glycosyltransferase 25 family member 3; CerCAM; GLT25D3; glycosyltransferase 25 domain containing 3; cerebral cell adhesion molecule; cerebral endothelial cell adhesion molecule 1; CEECAM1; MGC149620; MGC149621;
Gene ID 51148
mRNA Refseq NM_016174
Protein Refseq NP_057258
MIM 616626
UniProt ID Q5T4B2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CERCAM Products

Required fields are marked with *

My Review for All CERCAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon