Recombinant Full Length Human CERCAM Protein, GST-tagged
Cat.No. : | CERCAM-3247HF |
Product Overview : | Human CEECAM1 full-length ORF (NP_057258.2, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 517 amino acids |
Description : | CERCAM (Cerebral Endothelial Cell Adhesion Molecule) is a Protein Coding gene. An important paralog of this gene is COLGALT1. |
Molecular Mass : | 85.5 kDa |
AA Sequence : | MLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPRMQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFESNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CERCAM cerebral endothelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | CERCAM |
Synonyms | CERCAM; cerebral endothelial cell adhesion molecule; CEECAM1, cerebral cell adhesion molecule; glycosyltransferase 25 family member 3; CerCAM; GLT25D3; glycosyltransferase 25 domain containing 3; cerebral cell adhesion molecule; cerebral endothelial cell adhesion molecule 1; CEECAM1; MGC149620; MGC149621; |
Gene ID | 51148 |
mRNA Refseq | NM_016174 |
Protein Refseq | NP_057258 |
MIM | 616626 |
UniProt ID | Q5T4B2 |
◆ Recombinant Proteins | ||
CERCAM-1146H | Recombinant Human CERCAM Protein, GST-Tagged | +Inquiry |
CERCAM-3247HF | Recombinant Full Length Human CERCAM Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERCAM-332HCL | Recombinant Human CERCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERCAM Products
Required fields are marked with *
My Review for All CERCAM Products
Required fields are marked with *
0
Inquiry Basket