Recombinant Human CEL Protein, GST-Tagged

• Cat.No.: CEL-1109H
• Product Overview: Human CEL partial ORF (AAH42510, 378 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEL carboxyl ester lipase (bile salt-stimulated lipase) [ Homo sapiens ]
• Official Symbol: CEL
• Synonyms: CEL; carboxyl ester lipase (bile salt-stimulated lipase); bile salt-activated lipase; BSSL; MODY8; bucelipase; sterol esterase; cholesterol esterase; carboxyl ester hydrolase; bile-salt-activated lipase; pancreatic lysophospholipase; fetoacinar pancreatic protein; lysophospholipase, pancreatic; bile salt-dependent lipase, oncofetal isoform; BAL; FAP; BSDL; CELL; FAPP; LIPA; CEase
• Gene ID: 1056
• mRNA Refseq: NM_001807
• Protein Refseq: NP_001798
• MIM: 114840
• UniProt ID: P19835