Recombinant Human CEACAM8 protein, T7/His-tagged

• Cat.No.: CEACAM8-45H
• Product Overview: Recombinant human CD67 extracellular domain cDNA (35 - 320 aa, derived from BC026263) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 35-320 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIG YVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNP VEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTL NVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSAT GRNRTTVRMITVSD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used coating matrix protein for in vitro granulocytes differentiation regulations study.2. May be used for protein-protein interaction assay development.3. Potential diagnostic biomarker protein for acute myolofibrosis.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
• Official Symbol: CEACAM8
• Synonyms: CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95
• Gene ID: 1088
• mRNA Refseq: NM_001816
• Protein Refseq: NP_001807
• UniProt ID: P31997
• Chromosome Location: 19q13.2