Recombinant Human CEACAM8 Protein, GST-Tagged

• Cat.No.: CEACAM8-1098H
• Product Overview: Human CEACAM8 full-length ORF (AAH26263, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CEACAM8 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 8) is a Protein Coding gene. Diseases associated with CEACAM8 include Endocarditis and Shwartzman Phenomenon. Among its related pathways are Innate Immune System and Cell surface interactions at the vascular wall. An important paralog of this gene is CEACAM1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.02 kDa
• AA Sequence: MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
• Official Symbol: CEACAM8
• Synonyms: CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95
• Gene ID: 1088
• mRNA Refseq: NM_001816
• Protein Refseq: NP_001807
• MIM: 615747
• UniProt ID: P31997