Recombinant Human CEACAM8 Protein, His-SUMO-tagged

Cat.No. : CEACAM8-1162H
Product Overview : Recombinant Human CEACAM8 Protein (35-320aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 35-320 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 47.5 kDa
AA Sequence : QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
Official Symbol CEACAM8
Synonyms CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b
Gene ID 1088
mRNA Refseq NM_001816
Protein Refseq NP_001807
UniProt ID P31997

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEACAM8 Products

Required fields are marked with *

My Review for All CEACAM8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon