Recombinant Human CEACAM21 protein, HIS-tagged
Cat.No. : | CEACAM21-033H |
Product Overview : | Recombinant Human CEACAM21 fused with His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Molecular Mass : | 24.2kD |
AA Sequence : | WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ] |
Official Symbol | CEACAM21 |
Synonyms | CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874; |
Gene ID | 90273 |
mRNA Refseq | NM_001098506 |
Protein Refseq | NP_001091976 |
UniProt ID | Q3KPI0 |
◆ Recombinant Proteins | ||
CEACAM21-033H | Recombinant Human CEACAM21 protein, HIS-tagged | +Inquiry |
CEACAM21-1094H | Recombinant Human CEACAM21 Protein, GST-Tagged | +Inquiry |
CEACAM21-15898H | Recombinant Human CEACAM21, His-tagged | +Inquiry |
CEACAM21-1535H | Recombinant Human CEACAM21 Protein (Trp35-Gly240), C-His tagged | +Inquiry |
CEACAM21-3273HF | Recombinant Full Length Human CEACAM21 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM21-7599HCL | Recombinant Human CEACAM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM21 Products
Required fields are marked with *
My Review for All CEACAM21 Products
Required fields are marked with *
0
Inquiry Basket