Recombinant Human CEACAM21 protein, HIS-tagged

Cat.No. : CEACAM21-033H
Product Overview : Recombinant Human CEACAM21 fused with His tag at C-termina was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
Molecular Mass : 24.2kD
AA Sequence : WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ]
Official Symbol CEACAM21
Synonyms CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874;
Gene ID 90273
mRNA Refseq NM_001098506
Protein Refseq NP_001091976
UniProt ID Q3KPI0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEACAM21 Products

Required fields are marked with *

My Review for All CEACAM21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon