Recombinant Human CEACAM21 protein, HIS-tagged

• Cat.No.: CEACAM21-033H
• Product Overview: Recombinant Human CEACAM21 fused with His tag at C-termina was expressed in HEK293 cells.

Specification

• Source: HEK293 cells
• Species: Human
• Tag: HIS
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
• Molecular Mass: 24.2kD
• AA Sequence: WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH*
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ]
• Official Symbol: CEACAM21
• Synonyms: CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874
• Gene ID: 90273
• mRNA Refseq: NM_001098506
• Protein Refseq: NP_001091976
• UniProt ID: Q3KPI0