Recombinant Full Length Human CEACAM21 Protein, GST-tagged

Cat.No. : CEACAM21-3273HF
Product Overview : Human CEACAM21 full-length ORF (AAH12001.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CEACAM21 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 21) is a Protein Coding gene. An important paralog of this gene is CEACAM1.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 47.9 kDa
Protein length : 191 amino acids
AA Sequence : MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ]
Official Symbol CEACAM21
Synonyms CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874;
Gene ID 90273
mRNA Refseq NM_001098506
Protein Refseq NP_001091976
MIM 618191
UniProt ID Q3KPI0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEACAM21 Products

Required fields are marked with *

My Review for All CEACAM21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon