Recombinant Full Length Human CEACAM21 Protein, GST-tagged

• Cat.No.: CEACAM21-3273HF
• Product Overview: Human CEACAM21 full-length ORF (AAH12001.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 191 amino acids
• Description: CEACAM21 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 21) is a Protein Coding gene. An important paralog of this gene is CEACAM1.
• Molecular Mass: 47.9 kDa
• AA Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ]
• Official Symbol: CEACAM21
• Synonyms: CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874
• Gene ID: 90273
• mRNA Refseq: NM_001098506
• Protein Refseq: NP_001091976
• MIM: 618191
• UniProt ID: Q3KPI0