Recombinant Human CDKN2C protein, His-tagged

Cat.No. : CDKN2C-2988H
Product Overview : Recombinant Human CDKN2C protein(1-75 aa ), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-75 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ]
Official Symbol CDKN2C
Synonyms CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C;
Gene ID 1031
mRNA Refseq NM_001262
Protein Refseq NP_001253
MIM 603369
UniProt ID P42773

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDKN2C Products

Required fields are marked with *

My Review for All CDKN2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon