Recombinant Human CDC25C Protein, GST-Tagged

• Cat.No.: CDC25C-0918H
• Product Overview: Human CDC25C full-length ORF (AAH19089.1, 1 a.a. - 473 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]
• Molecular Mass: 79.7 kDa
• AA Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC25C cell division cycle 25 homolog C (S. pombe) [ Homo sapiens ]
• Official Symbol: CDC25C
• Synonyms: CDC25C; cell division cycle 25 homolog C (S. pombe); CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25C; M-phase inducer phosphatase 3; PPP1R60; protein phosphatase 1; regulatory subunit 60; mitosis inducer CDC25; cell division cycle 25C; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60; CDC25
• Gene ID: 995
• mRNA Refseq: NM_001790
• Protein Refseq: NP_001781
• MIM: 157680
• UniProt ID: P30307