Recombinant Human CD3G

• Cat.No.: CD3G-26368TH
• Product Overview: Recombinant fragment of Human CD3G with proprietary tag; predicited MWt 35.42 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Description: The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
• Molecular Weight: 35.420kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
• Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.

Gene Information

• Gene Name: CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3G
• Synonyms: CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain
• Gene ID: 917
• mRNA Refseq: NM_000073
• Protein Refseq: NP_000064
• Uniprot ID: P09693
• Chromosome Location: 11q23
• Pathway: Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem
• Function: T cell receptor binding; protein heterodimerization activity; receptor activity; receptor signaling complex scaffold activity; transmembrane signaling receptor activity