Recombinant Human CD3G Protein, C-His-tagged

• Cat.No.: CD3G-170H
• Product Overview: Recombinant Human CD3G Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The T cell antigen receptor (TCR) recognizes foreign antigens and translates such recognition events into intracellular signals that elicit a change in the cell from a dormant to an activated state. Much of this signaling process can be attributed to a multisubunit complex of proteins that associates directly with the TCR. This complex has been designated CD3 (cluster of differentiation 3). It is composed of five invariant polypeptide chains that associate to form three dimers: a heterodimer of γ and ε chains (γε), a heterodimer of δ and ε chains (δε) and a homodimer of two ζ chains (ζζ) or a heterodimer of ζ and η chains (ζη). The ζ and η chains are encoded by the same gene but differ in their carboxyl-terminal ends due to an alternative splicing event. The γ, ε and δ chains each contain a single copy of a conserved immunoreceptor tyrosinebased activation motif (ITAM). In contrast, the ζ chain contains three consecutive copies of the same motif. Phosphorylated ITAMs act as docking sites for protein kinases such as ZAP-70 and Syk and are also capable of regulating their kinase activity. The crystal structure of the ZAP-70 SH2 domains bound to the ζ chain ITAMs has been solved.
• Molecular Mass: ~10 kDa
• AA Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens (human) ]
• Official Symbol: CD3G
• Synonyms: CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597
• Gene ID: 917
• mRNA Refseq: NM_000073
• Protein Refseq: NP_000064
• MIM: 186740
• UniProt ID: P09693