Recombinant Human CD3G Protein, GST-Tagged

• Cat.No.: CD3G-0805H
• Product Overview: Human CD3G partial ORF (NP_000064, 23 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.53 kDa
• AA Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3G
• Synonyms: CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597
• Gene ID: 917
• mRNA Refseq: NM_000073
• Protein Refseq: NP_000064
• UniProt ID: P09693