Recombinant Human CD320 Protein (36-231 aa), GST-tagged

• Cat.No.: CD320-1249H
• Product Overview: Recombinant Human CD320 Protein (36-231 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 36-231 aa
• Description: Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 47.1 kDa
• AA Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CD320 CD320 molecule [ Homo sapiens (human) ]
• Official Symbol: CD320
• Synonyms: 8D6; 8D6A; TCBLR; TCN2R
• Gene ID: 51293
• UniProt ID: Q9NPF0