Recombinant Human CD320 Protein

Cat.No. : CD320-0787H
Product Overview : Human CD320 full-length ORF (NP_057663.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011]
Form : Liquid
Molecular Mass : 29 kDa
AA Sequence : MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD320 CD320 molecule [ Homo sapiens (human) ]
Official Symbol CD320
Synonyms CD320; CD320 molecule; 8D6; 8D6A; TCBLR; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin receptor; CD320 Antigen; 8D6 Antigen; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; FDC-SM-8D6
Gene ID 51293
mRNA Refseq NM_001165895
Protein Refseq NP_001159367
MIM 606475
UniProt ID Q9NPF0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD320 Products

Required fields are marked with *

My Review for All CD320 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon