Recombinant Human CD320 Protein, Fc-tagged
Cat.No. : | CD320-043H |
Product Overview : | Recombinant Human CD320 fused with Fc tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Source : | HEK293 cells |
Tag : | Fc |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0 |
Molecular Mass : | 47.3kD |
AA Sequence : | SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD320 CD320 molecule [ Homo sapiens (human) ] |
Official Symbol | CD320 |
Synonyms | 8D6; 8D6A; TCBLR; CD320; |
Gene ID | 51293 |
mRNA Refseq | NM_001165895.1 |
Protein Refseq | NP_057663 |
MIM | 606475 |
UniProt ID | F5H6D3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CD320 Products
Required fields are marked with *
My Review for All CD320 Products
Required fields are marked with *
0
Inquiry Basket