Recombinant Human CD300c protein, T7/His-tagged

• Cat.No.: CD300c-73H
• Product Overview: Recombinant human CD300c cDNA (21 – 183 aa, derived from BC022279) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 21-183 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCD KIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASS PQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD300c protein mediated TH1 and TH17 cell function regulation with this protein as either coating matrix protein or soluble factor.2. May be used for CD300c protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential biomarker protein for differentiating patients with ulcerative colitis in Crohn"s disease from non-inflammatory diarrhea.5. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CD300C CD300c molecule [ Homo sapiens ]
• Official Symbol: CD300c
• Synonyms: CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leuko
• Gene ID: 10871
• mRNA Refseq: NM_006678
• Protein Refseq: NP_006669
• MIM: 606786
• UniProt ID: Q08708
• Chromosome Location: 17q25.2
• Function: receptor activity; transmembrane signaling receptor activity