Recombinant Human CD151 Protein, C-His-tagged
Cat.No. : | CD151-211H |
Product Overview : | Recombinant Human CD151 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD151 (PETA-3, SFA-1) is a member of the evolutionarily conserved tetraspanin family of multipass glycoproteins (TM4SF), highlighted by four transmembrane domains, two extracellular loops, and N/C-termini that reside within the cytoplasm. Identified as the first member of the tetraspanin family to be implicated in tumorigenesis, research studies have demonstrated that CD151 participates in tumor neovascularization, tumor cell cell invasion, and cell adhesion. Furthermore, a positive correlation exists between CD151 expression levels and poor prognosis for tumors of the lung, kidney, and prostate. CD151 is localized predominantly to the plasma membrane and research studies have demonstrated that CD151 exerts its pro-tumorigenic effects, in part, through the modulation of laminin-binding integrins and oncogenic receptor tyrosine kinases, such as c-Met and EGFR. |
Molecular Mass : | ~12 kDa |
AA Sequence : | AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD151 CD151 molecule (Raph blood group) [ Homo sapiens (human) ] |
Official Symbol | CD151 |
Synonyms | CD151; CD151 molecule (Raph blood group); CD151 antigen , CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3; |
Gene ID | 977 |
mRNA Refseq | NM_001039490 |
Protein Refseq | NP_001034579 |
MIM | 602243 |
UniProt ID | P48509 |
◆ Recombinant Proteins | ||
CD151-211H | Recombinant Human CD151 Protein, C-His-tagged | +Inquiry |
CD151-2786H | Recombinant Human CD151 protein, His-tagged | +Inquiry |
CD151-0905H | Recombinant Human CD151 Protein (Met1-Ser167), N-His tagged | +Inquiry |
CD151-1236R | Recombinant Rat CD151 Protein | +Inquiry |
CD151-2985HF | Recombinant Full Length Human CD151 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
0
Inquiry Basket