Recombinant Human CD151 protein, His-tagged
Cat.No. : | CD151-2786H |
Product Overview : | Recombinant Human CD151 protein(113-221 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 113-221 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD151 CD151 molecule (Raph blood group) [ Homo sapiens ] |
Official Symbol | CD151 |
Synonyms | CD151; CD151 molecule (Raph blood group); CD151 antigen , CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3; |
Gene ID | 977 |
mRNA Refseq | NM_001039490 |
Protein Refseq | NP_001034579 |
MIM | 602243 |
UniProt ID | P48509 |
◆ Recombinant Proteins | ||
CD151-2786H | Recombinant Human CD151 protein, His-tagged | +Inquiry |
CD151-1587R | Recombinant Rhesus Monkey CD151 Protein, hIgG4-tagged | +Inquiry |
RFL26107BF | Recombinant Full Length Bovine Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
CD151-718R | Recombinant Rhesus monkey CD151 Protein, His-tagged | +Inquiry |
CD151-1585R | Recombinant Rhesus Monkey CD151 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
0
Inquiry Basket