Recombinant Human CCNT2 Protein, GST-Tagged

• Cat.No.: CCNT2-0682H
• Product Overview: Human CCNT2 partial ORF (NP_490595, 264 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. A pseudogene of this gene is found on chromosome 1. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]
• Molecular Mass: 37.51 kDa
• AA Sequence: RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCNT2 cyclin T2 [ Homo sapiens ]
• Official Symbol: CCNT2
• Synonyms: CCNT2; cyclin T2; cyclin-T2; cyclin T2a; cyclin T2b; SDS-stable vimentin-bound DNA fragment HEF42VIM22; subunit of positive elongation transcription factor b; CYCT2; FLJ13583; FLJ90560; MGC134840
• Gene ID: 905
• mRNA Refseq: NM_001241
• Protein Refseq: NP_001232
• MIM: 603862
• UniProt ID: O60583