Recombinant Human CCNT2
Cat.No. : | CCNT2-27017TH |
Product Overview : | Recombinant fragment of Human Cyclin T2 protein with an N terminal proprietary tag; Predicted MW 37.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 107 amino acids |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. A pseudogene of this gene is found on chromosome 1. Alternate splicing results in multiple transcript variants. |
Molecular Weight : | 37.400kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQK PSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSY GLSSHQEWPQHQDSARTEQLYSQKQET |
Sequence Similarities : | Belongs to the cyclin family. Cyclin C subfamily. |
Gene Name | CCNT2 cyclin T2 [ Homo sapiens ] |
Official Symbol | CCNT2 |
Synonyms | CCNT2; cyclin T2; cyclin-T2; |
Gene ID | 905 |
mRNA Refseq | NM_001241 |
Protein Refseq | NP_001232 |
MIM | 603862 |
Uniprot ID | O60583 |
Chromosome Location | 2q21.3 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; Gene Expression, organism-specific biosystem; HIV Infection, organism-specific biosystem; |
Function | protein kinase binding; |
◆ Recombinant Proteins | ||
CCNT2-0682H | Recombinant Human CCNT2 Protein, GST-Tagged | +Inquiry |
CCNT2-27017TH | Recombinant Human CCNT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNT2-7701HCL | Recombinant Human CCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNT2 Products
Required fields are marked with *
My Review for All CCNT2 Products
Required fields are marked with *
0
Inquiry Basket