Recombinant Human CAST Protein (1-667 aa), His-tagged
Cat.No. : | CAST-1350H |
Product Overview : | Recombinant Human CAST Protein (1-667 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of isoform 4. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-667 aa |
Description : | Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmort tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 73.9 kDa |
AA Sequence : | MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CAST calpastatin [ Homo sapiens ] |
Official Symbol | CAST |
Synonyms | CAST; calpastatin; BS-17; MGC9402; |
Gene ID | 831 |
mRNA Refseq | NM_001042440 |
Protein Refseq | NP_001035905 |
MIM | 114090 |
UniProt ID | P20810 |
◆ Recombinant Proteins | ||
Cast-776M | Recombinant Mouse Cast Protein, MYC/DDK-tagged | +Inquiry |
CAST-0441H | Recombinant Human CAST Protein, GST-Tagged | +Inquiry |
CAST-10743H | Recombinant Human CAST, GST-tagged | +Inquiry |
CAST-1350H | Recombinant Human CAST Protein (1-667 aa), His-tagged | +Inquiry |
CAST-1149R | Recombinant Rat CAST Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAST-7824HCL | Recombinant Human CAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAST Products
Required fields are marked with *
My Review for All CAST Products
Required fields are marked with *
0
Inquiry Basket