Recombinant Human CARD16 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CARD16-6035H
• Product Overview: CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Diseases associated with CARD16 include Nodular Lymphocyte Predominant Hodgkin Lymphoma and Panhypopituitarism, X-Linked. Among its related pathways are NOD-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CASP1.
• Molecular Mass: 10.6 kDa
• AA Sequence: MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CARD16 caspase recruitment domain family member 16 [ Homo sapiens (human) ]
• Official Symbol: CARD16
• Synonyms: CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE
• Gene ID: 114769
• mRNA Refseq: NM_052889
• Protein Refseq: NP_443121
• MIM: 615680
• UniProt ID: Q5EG05