Recombinant Human CARD16 Protein, GST-tagged

• Cat.No.: CARD16-1690H
• Product Overview: Human COP1 full-length ORF ( NP_443121.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD17.
• Molecular Mass: 37.1 kDa
• AA Sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARD16 caspase recruitment domain family, member 16 [ Homo sapiens ]
• Official Symbol: CARD16
• Synonyms: CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE
• Gene ID: 114769
• mRNA Refseq: NM_001017534
• Protein Refseq: NP_001017534
• MIM: 615680
• UniProt ID: Q5EG05