Recombinant Human CAPSL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CAPSL-4678H
Product Overview : CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CAPSL (Calcyphosine Like) is a Protein Coding gene. Diseases associated with CAPSL include Lipomatosis, Multiple Symmetric. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS.
Molecular Mass : 23.1 kDa
AA Sequence : MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CAPSL calcyphosine-like [ Homo sapiens (human) ]
Official Symbol CAPSL
Synonyms CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610;
Gene ID 133690
mRNA Refseq NM_001042625
Protein Refseq NP_001036090
MIM 618799
UniProt ID Q8WWF8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPSL Products

Required fields are marked with *

My Review for All CAPSL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon