Recombinant Human CAPSL Protein, GST-Tagged

Cat.No. : CAPSL-0381H
Product Overview : Human CAPSL full-length ORF (AAH17586.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CAPSL (Calcyphosine Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 49.5 kDa
AA Sequence : MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAPSL calcyphosine-like [ Homo sapiens ]
Official Symbol CAPSL
Synonyms CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610;
Gene ID 133690
mRNA Refseq NM_001042625
Protein Refseq NP_001036090
UniProt ID Q8WWF8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPSL Products

Required fields are marked with *

My Review for All CAPSL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon