Recombinant Full Length Human CAPSL Protein, GST-tagged

• Cat.No.: CAPSL-2846HF
• Product Overview: Human CAPSL full-length ORF (AAH17586.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CAPSL (Calcyphosine Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 49.5 kDa
• Protein length: 198 amino acids
• AA Sequence: MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CAPSL calcyphosine-like [ Homo sapiens ]
• Official Symbol: CAPSL
• Synonyms: CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610
• Gene ID: 133690
• mRNA Refseq: NM_001042625
• Protein Refseq: NP_001036090
• MIM: 618799
• UniProt ID: Q8WWF8