Recombinant Human CAPSL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CAPSL-1160H
• Product Overview: CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_653248) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CAPSL (Calcyphosine Like) is a Protein Coding gene. Diseases associated with CAPSL include Lipomatosis, Multiple Symmetric. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS.
• Molecular Mass: 23.1 kDa
• AA Sequence: MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CAPSL calcyphosine-like [ Homo sapiens (human) ]
• Official Symbol: CAPSL
• Synonyms: CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610
• Gene ID: 133690
• mRNA Refseq: NM_144647
• Protein Refseq: NP_653248
• MIM: 618799
• UniProt ID: Q8WWF8