Recombinant Human CACNA2D1 protein, His-SUMO-tagged

• Cat.No.: CACNA2D1-2619H
• Product Overview: Recombinant Human CACNA2D1 protein(P54289)(577-717aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 577-717aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.3 kDa
• AA Sequence: KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ]
• Official Symbol: CACNA2D1
• Synonyms: CACNA2D1; calcium channel, voltage-dependent, alpha 2/delta subunit 1; CACNA2, CACNL2A, MHS3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; voltage-gated calcium channel subunit alpha-2/delta-1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; CACNA2; CCHL2A; CACNL2A
• Gene ID: 781
• mRNA Refseq: NM_000722
• Protein Refseq: NP_000713
• MIM: 114204
• UniProt ID: P54289