Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged

• Cat.No.: CACNA2D1-2301H
• Product Overview: Recombinant Human CACNA2D1 Protein (577-717 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.3 kDa
• Protein length: 577-717 aa
• AA Sequence: KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ]
• Official Symbol: CACNA2D1
• Synonyms: CACNA2D1; CACNA2; CCHL2A; CACNL2A
• Gene ID: 781
• mRNA Refseq: NM_000722
• Protein Refseq: NP_000713
• MIM: 114204
• UniProt ID: P54289